PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P27530_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 257aa    MW: 28718.4 Da    PI: 7.8267
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P27530_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.4e-18106160256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Le+ F+++++++ ++++ LA +l+L  rq+ vWFqNrRa+ k
  GSMUA_Achr7P27530_001 106 RKKLRLTKEQSALLEDRFKEHSTINPKQKQTLAGQLNLRPRQIEVWFQNRRARTK 160
                            678899***********************************************98 PP

2HD-ZIP_I/II112.82.2e-36106194190
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq++lLE+ F+e+++++p++K++la +L+l+prq++vWFqnrRARtk+k++E+d + Lkr +++l++en+rL+ke ++L+
  GSMUA_Achr7P27530_001 106 RKKLRLTKEQSALLEDRFKEHSTINPKQKQTLAGQLNLRPRQIEVWFQNRRARTKLKKMEVDSTILKRYCEKLSDENQRLQKELQQLK 193
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 ee 90 
                             +
  GSMUA_Achr7P27530_001 194 -A 194
                            .4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.65E-17102163IPR009057Homeodomain-like
PROSITE profilePS5007116.73102162IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-17104165IPR009057Homeodomain-like
SMARTSM003897.1E-15104166IPR001356Homeobox domain
PfamPF000462.7E-15106160IPR001356Homeobox domain
CDDcd000862.95E-15106163No hitNo description
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PfamPF021832.6E-7162195IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.3E-15162205IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDISQEGDRD INLALELCIG KRSDKSRDHG EEACSNSRKL SLPLGLFHGV EAEEGSAAGV  60
SSHHSTVSSV SCLPSVKKEN HAGDEEEEAE RLSSRGSDEE DEGGVRKKLR LTKEQSALLE  120
DRFKEHSTIN PKQKQTLAGQ LNLRPRQIEV WFQNRRARTK LKKMEVDSTI LKRYCEKLSD  180
ENQRLQKELQ QLKALTAAPP LYMHFPAAAS LTMCPTCGRR TERAGDGPRG HDCYAGPLLV  240
APKPYFLNPS FIQQHVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411329.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like isoform X1
SwissprotP466048e-58HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLM0TL890.0M0TL89_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27530_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-58HD-ZIP family protein